SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015008 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015008
Domain Number 1 Region: 71-253
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.47e-79
Family T-box 0.00000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015008   Gene: ENSMPUG00000015118   Transcript: ENSMPUT00000015245
Sequence length 679
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:11734282:11743322:1 gene:ENSMPUG00000015118 transcript:ENSMPUT00000015245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LARPPASLSSPSRSAGAPGCAAAESGVGGQAGARARAAGPPXVSALGPHPPAAHLRSLKS
LEPEDEVEDDPKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILL
MDIVAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNN
ISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQL
KIDNNPFAKGFRDTGNGRREKRKQLTLPSLRLYEEHCKPERDGAESDASSCDPAPAREQP
PSPGSAPSPLRLHRTRAEEKSCAADSDPEPERLSEERAGPALGRSPALDSGSPPRLTEPE
RTRERRSPERGKEPAESGGDGPFGLRSLEKERAEARRKDDGRKEAGEGKEPGLAPLVVQT
DSASPLGAGHLPGLAFSGHLHGQQFFGPLGAGQPLFLHPGQFAMGPGAFSAMGMGHLLAS
VAGGGGSGGGGGPGTATGLDASGLGPAASAANTAAPFPFHLSQHMLASQGIPMPTFGGLF
PYPYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSHFLGSARPRLRFSPYQIPVTIPPS
ASLLTTGLAAEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAASELQSIQR
LVSGLESQRALSPGRESPK
Download sequence
Identical sequences M3YUJ8
ENSMPUP00000015008 ENSMPUP00000015008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]