SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015068 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015068
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.57e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.93e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000853
Further Details:      
 
Domain Number 3 Region: 606-713
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.66e-27
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000144
Family TGS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015068   Gene: ENSMPUG00000015177   Transcript: ENSMPUT00000015305
Sequence length 723
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:43642209:43668838:-1 gene:ENSMPUG00000015177 transcript:ENSMPUT00000015305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKDRSPSGKMGGEEKPVGAGEEKRKDGGKKKNKEGSGDGGRAELNPWPEYINTRLEM
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVNAESWKTTPYQIACGISQGLADNTVIA
KVNQVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRIL
NEKVTTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFI
RSEYRKRGFQEVVTPNIYNSRLWMTSGHWQHYSDNMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRIADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSVFGFSFKLNLSTRPEKFLGDVEVWNQAEKQLENSLNEFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERM
IAILTENFGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKASSTVNIRTRDNKVHGERTIAETIERLQQLKQSRSRQAE
EEF
Download sequence
Identical sequences M3YUQ8
XP_004738119.1.14098 ENSMPUP00000015068 ENSMPUP00000015068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]