SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015086 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015086
Domain Number 1 Region: 173-518,597-621
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.45e-82
Family Myotubularin-like phosphatases 0.0000671
Further Details:      
 
Domain Number 2 Region: 16-159
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000016
Family TFIIH domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015086   Gene: ENSMPUG00000015196   Transcript: ENSMPUT00000015324
Sequence length 720
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:44601832:44643561:1 gene:ENSMPUG00000015196 transcript:ENSMPUT00000015324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQRGIYGKLVCTDFKIAFLGD
DESALDNDETQFKNKVIGENDITLHCVDQIYGVFDEKKKPLFGQLKKYPEKLIIHCKDLR
VFHFGLRYTKEEEVKRIVSGIIHHTQVPKLLKRLFLFSYAAATQNNTATDPKNHTVMFDT
LKDWCWELERTKGNVKYKAVSVNEGYDVSERLPAYFVVPTPLPEEDVRCFQGRGIPIWCW
SCHNGCAILKMSALPKEPDDGLLQNQKSFLDGIYKTIHRPPYETVKTEDLSSNFLSLQDI
QTAYSKFKQLFLIDNSTEFWDTDIKWFSLLESSSWLDITRRCLKKAIEITECLEAQNMNV
LLLEENASDLCCLLSSLVQVMMDPHCRTRAGFQSLVQKEWIMGGHCFLDRCNHLRQSDKE
EVPVFQLFLDCVWQLVHQHPPAFDFTETYLTVLSDSLYIPIFSTFFFNSPHQKETNMGRE
SQETQSKPLNLLTVWDWSVQFEPKAQMLLKNPLYVEKPKLDKGQRKGTRFKHQRQLSLPL
TQSKSSPKRGFFREETDHLIKNLLGKRISKLINSSDELQDNFREFYESWHSKPTDYHSLL
LPHIEGPEIKVWAQRYLRWIPEAQILGGGRVATMSKLLEMMEEVEHLQEKIDERHHSQEA
LPAEAPALLRSSARLSSLFPFALLQRQSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV
Download sequence
Identical sequences M3YUS6
ENSMPUP00000015086 ENSMPUP00000015086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]