SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015121 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015121
Domain Number 1 Region: 326-421
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-24
Family PDZ domain 0.0066
Further Details:      
 
Domain Number 2 Region: 585-672
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-24
Family PDZ domain 0.052
Further Details:      
 
Domain Number 3 Region: 2739-2832
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-23
Family Interleukin 16 0.0053
Further Details:      
 
Domain Number 4 Region: 2596-2711
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-18
Family Interleukin 16 0.0042
Further Details:      
 
Domain Number 5 Region: 720-817
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-17
Family PDZ domain 0.014
Further Details:      
 
Domain Number 6 Region: 64-184
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000171
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015121   Gene: ENSMPUG00000015230   Transcript: ENSMPUT00000015359
Sequence length 2836
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:44765610:44990529:-1 gene:ENSMPUG00000015230 transcript:ENSMPUT00000015359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPITQDNAVLHLPLLYQWLQNSLREGGDGPEQRLCQAAIQKLQEYIQLNFAVDESAVPPD
RSPPGMEICTVYLTKELGDAETVGLSFGNIPVFGDYGEKRRGGKKRKTHQGPVLDVGCIW
VTELRKNSPAGKSGKVRLRDEILSLNGQLMVGVDVSGASYLAEQCWNGGFIYLIMLRRFK
HKVHSPYNGSSSNSSEPGETPTLELGDQAVKKGKRARKFGVISRPSPQKTTEEPKSGPGC
ELDNDPISESDNGPDPELGNGHAFELENGPESLKELAGSHLDSSEADRGTEHSIPKTDAS
LPTSNDKHRFSKSGKTDFQSSDCLAREEVGRIWKMELLKESDGLGIQVSGGRGSKRSPHA
IVVTQVKEGGAAHRDGRLSLGDELLVINGHLLVGLSHEEAVAILRAATGMVQLVVASKEN
SAEDILRLTSKSLPDLTSSVEDVSSWTDNEDQEPNGEEDEGPGSSSVRGAMPGTEESQDS
GGPEESKGNLESPKQGSSKMKLKSRLSGGVHRLESVEEYNELMVRNGDPRIRMLEVSRDG
RKHSLPQLLDSTGTSQEYHIVKKSTRSLSTTQVESPWRLIRPSVISIIGLYKEKGKGLGF
SIAGGRDCIRGQMGIFVKTIFPNGSAAEDGRLKEGDEILDVNGIPIKGLTFQEAIHTFKQ
IRSGLFVLTVRTKLLSPSLTPCSTPTHMSRSSSPNFNTSSGSSAAGPEEGSSLSLGRKAP
GPKDRIVMEVTLNKEPRVGLGIGACCLALDNSPPGIYIHSLAPGSVAKMESNLSRGDQIL
EVNSVNVRHAALSKVHTILSKCPPGPVRLVIGRHPNPKISEQEMDAVIARSTYQESKEAS
SSPGSGTPLKSPSLAKKDALTSEAEASPYFAHSVPGSLSDFVVAASEDEDPPGSGGSTSE
DGGPPAKTSTHKEPGKPRANSLVTLGSQRSSGLFHKQVTVARQASLPGSPQPPRNPLLRQ
RRVGCYDTDDASDEEEFDGEGDCISLPGTLPGPSRPLTEVNSRHTLMTSSKVMGINSRGE
QPQKTVVSKASSVPLLGSSLDLEESVPEGLGDTPSRAANLLASAEAHRGGPGCSGRKELS
GSKSSPKLEYKADTGTQSLGNTDPPRSAQQKNDSLGSRHKPVARVSPHHKRPEADARPST
SETVHLTAGADVPCVRATSSKETRPGFHPGGMAEKESLGKLSIIGDEHVPASWEPAAALS
HPDASRCPENLLEAAPEQGQQPRTGLVGPPELVPTPGQKWAAHPDPSKTSVDTGQARRPE
DPREPVAPRVPESEDRCQVGPGPERSSSPKKTAAARHDFSNPPAAPEASSPRKAAALGGG
PEAERASPAGTALSRDLTSPEERPRVPGNHSKAPQTTAVLVPESSRGSALLKGTDSGSER
APQASPTLPSPADKAGGGCGSVSGHCCPRERGGSPVTDIDKLIKELDTSEPRLRSPHGGD
QLTPEGHSQGQPPAGAGSGGSRPAEPVLGSQTPTPGRTWAAAGQPPHPHWASQPSVLDSI
NPDKHFTVNKNFLSNYSRNFSSFHEDSMSLSGLGDSTEPSLSSMYGDAEDSSSDPESLSE
APRASSGDNWSPPRSRRSSHKENTTESEEEQIEICSPDGSPHAPPATAPAPAQPAPCPVP
ARVLRLKHSALRQVVGNPRERASFVPGTSCPSIPDSSQPFSLLDTSSREHELHADRRPSQ
DPRPSCEEETLQDPRAGSAVESGRPPKAPGHFHSLPVTLRSLNVVNGLEHDLLGDKTPHK
KQDTNVSDAENPSPFSTDVPKNGESVLTTLHISESQDVDDPLQKPKMISRRPIMAWFKEI
NKNNHGSAAQGKTEKEQPVVPARSPDSKSQGSSSCHKKGVAGLQSPPQLKVSLENKDPPK
KGSVETPLNNGQKPKSGPKLKRLSIKSKSKVTSEAPVAPGAKASGMDPRKPLISPQTSHR
ALPKGAAPRFHTTELEEPEKSATAAPRPPQCVLESRPPAASGSPKPPAAETSVPASVSPH
TSPRTLPEQGACRRSQAAFHPEPDGPYAATPGSPRCSPESRAPAAALGSSASPAARGQDV
PPPGPSTRRGSSQTDPAPQAAQPGVTCDRGSKIVAGDPLERTNQLKIVEISCERMPKNGC
SDKPAESDRLGGFWAQSNCQDKSEIRPCHQYLEPSAHQPPSFPSRASQVEPESQRPFGVA
KLASSSSSPQLPAKKADSSQAKASQASGSLGMPRNGAAGGPAPEDHPYFTPRPATRTYSM
PAQFSSHFGREGHGLPSPGRSHRDSQILATSGGLPEAKASRGIVLGLANGQGVYSVKPLL
ETSRNLPTTDEGDVLSVQERSSLVTDKIKVTRRHYYPEQNYESTSFFSVKQRIKSFENLA
NSDRLVAKSGASPFLSVSSKPPIGRRSSGSIVSGGLSHPVDVTARSLRRSLSSCSESQSE
ASTLIPQMSKSPSSMMLTVSRQNPAEAGNKAADLDPKKSLGPSGIPTHPVTPASPSKRNK
SSVRHTQPSPLSRSKLQELRALSMPDLDKLCSEDFPAGPTAGLFKTELEIVPRRSLGSPA
GGLSGSTALSCPMKPGDGACPGRSSPKASEPEGPSAAHHVGETTGDLPSGKGWSVNLDQL
LISAGDQQRVQSVLSSVGSPSTVLTLIQEAKAQSENKEDVCFIVLNKKEGSGLGFTVAGG
TDVEPKSIVVHRVCSQGAASQEGTVNRGDFLLSVNGASLAGLAHGDVLKILHQAQLHRDV
LVVIKKGNDQPRPSSRQEANGKGLLSRKTSALEPGLGSSLPSHDALCVEVLKTSAGLGLS
LDGGKSSTAGDGPLFIKRVYKGGAAEQAGTIEAGDEILAINGKPLVGLMHFDAWTIMKSV
PEGPVQLLIRKHRNSS
Download sequence
Identical sequences M3YUW1
ENSMPUP00000015121 ENSMPUP00000015121 XP_004738126.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]