SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015159 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015159
Domain Number 1 Region: 123-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.98e-119
Family Myotubularin-like phosphatases 0.000000347
Further Details:      
 
Domain Number 2 Region: 17-115
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000148
Family GRAM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015159   Gene: ENSMPUG00000015269   Transcript: ENSMPUT00000015398
Sequence length 540
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:15494345:15501160:1 gene:ENSMPUG00000015269 transcript:ENSMPUT00000015398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLELIRTGRAQVKLLRGPEAPPLRGTLCVTGHHLLLSPGPQGTSDLWLLLLRSVDSIE
KRVSGDSGTITLRCKDLRVLQLDIEGVEATLDIARSIEALSSLESVITSFPFFYRPRGLR
LGDAWHFHPPERYYKRVARETNAWRLSEVNEDFSLCPSYPRAVIVPRAVDDDALARCARF
RQGGRFPVLSYHHAPSGTVLLRSSQPLTGPQKRRCAEDEELLRAVLAGARPGAPGFILDT
RSAQAAKQAGVTVGGTEAKAAYPGWKRLHRPLEKGRPLQESFVRLVEACGDLEKSMDGWL
SQLEACCWLAHVKEALSTACLAAWGMEREEACILVHGAEGMDNTLLVTSLAQIILDPLSR
TMTGFQELVEREWIQAGHPFQLRCAHSAFSHAQPKHEAPTFLLFLDCVWQLGRQFPLSLE
FGEGLLLALFEHAYASPFGTFLCSSEKERCLCEVRTRTHSLWSGLNQPKVRRKLRNPLYI
PNPLAIWPSVEPQSLQLWQGLFLRWIRPPEPSQVAWEKVWQRLASKEKTEDCESTSKPQS
Download sequence
Identical sequences M3YUZ9
ENSMPUP00000015159 ENSMPUP00000015159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]