SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015162 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015162
Domain Number 1 Region: 137-329
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.86e-71
Family T-box 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015162   Gene: ENSMPUG00000015272   Transcript: ENSMPUT00000015401
Sequence length 535
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:2428115:2439668:1 gene:ENSMPUG00000015272 transcript:ENSMPUT00000015401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIVARGCGDMLTGTEPMPASDEGRAPGADPQNRYFYPDPGAQDAADRRGGATLGAPYAG
GALVPAPPGRFLGAYAYPPRPQATGFPGVGEPFPPTASAEGYQPGDGYAAPDPRSGLYPG
PREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPT
SHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFG
KLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFI
AVTAYQNAEITQLKIDNNPFAKGFRENFESMYASVDTSVPSPPGPNCQLLGGDHYSPLLP
NQYPVPSRFYPDLPGQAKDVASQPYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY
RGQDVLAPGAGWPMAPQYPPKMGPGSWFRPMRTLPMEPGPGASEGRGPEDQGSPSVWTEI
TPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKETEGQFYSYFPN
Download sequence
Identical sequences M3YV02
ENSMPUP00000015162 ENSMPUP00000015162 XP_004764765.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]