SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015166 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015166
Domain Number 1 Region: 470-833
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.48e-122
Family Oxysterol-binding protein 0.0018
Further Details:      
 
Domain Number 2 Region: 49-146
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-18
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015166   Gene: ENSMPUG00000015276   Transcript: ENSMPUT00000015405
Sequence length 838
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:2486586:2502116:-1 gene:ENSMPUG00000015276 transcript:ENSMPUT00000015405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQERVPNSLAESIQSTKLSSAQQASELWEVVEEPRSRLGAEGVMPERKEGHLLKKRKW
PLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDVRLSVMSINKKAQRIDLDTEDNIY
HLKIKSQDLFQSWVAQLRAHRLTMPRGSLPGTTHRKVPGAQLPAAGSASTLPGVGPREKV
SSWLRDSDGLDRCSHELSECQGKLQELHRLLQSLESLHRIPSAPVIPTHQASGTTERPRK
GKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDPSGPRGLPPPDYAHLQRTFW
ALAQKVHNSLSSVLAALTAEWDHLRDLHQGSELSRTGVSEASAGPRRLHSLSVSSDTTAD
SFSSLNPEEQEALYMKGRELTPQLSQSSILSLADSHTEFFDACEVLLSASSSENEGSEEE
ESCTSEITTSLSEEVLDLRGAERHQKGASVPGRAAGPPRRRCLPAASGPGTDVSLWNILR
NNIGKDLSKVSMPVQLNEPLNTLQRLCEELEYSSLLDRASRTADPCERMVYIAAFAVSAY
SSTYHRAGCKPFNPVLGETYECERPDRGFRFISEQVSHHPPISACHAESENFVFWQDMKW
KNKFWGKSLEIVPVGTVNVSLPRFGDHFEWNKVTSCIHNILSGQRWIEHYGEVLIRNTQD
SSCHCKLTFCKAKYWSSNVHEVQGAVFSRSGRVLHRLSGKWHEGLYRGTLPGGQCIWKPN
SMPPDHERNFGFTQFALELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQKRRIE
QLQRDRRRVMEENNIVHQARFFRRQTDSSGKEWWVTNNTYWRLRAEPGYGNLDGAVLW
Download sequence
Identical sequences M3YV06
ENSMPUP00000015166 XP_004764766.1.14098 ENSMPUP00000015166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]