SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015189 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015189
Domain Number 1 Region: 1326-1439
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.23e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 10-155
Classification Level Classification E-value
Superfamily RUN domain-like 1.22e-24
Family RUN domain 0.0027
Further Details:      
 
Domain Number 3 Region: 1133-1179
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000259
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015189
Domain Number - Region: 883-1011
Classification Level Classification E-value
Superfamily Tropomyosin 0.0168
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015189   Gene: ENSMPUG00000015299   Transcript: ENSMPUT00000015428
Sequence length 1441
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:3967955:4023570:1 gene:ENSMPUG00000015299 transcript:ENSMPUT00000015428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQLRVPVCCLKDAVTELSKEFKEAGEPITDDSTSLHKFSYKLEYLLQFDQKEKATLLGNR
KDYWDYFCACLAKVKGANDGIRFVKSIPELRPSWVRIFAFLCYCCHQSLFLLPCSDWYYA
RSPFLKPKLSSDIVGQLYELTEVQFDLASRGYDLDAAWPTFARRTLAPGSSAYLWKPPSR
SSSMSSLVSSYLQTQEMASSLDVSSPLNNEALEGFDEMRLELDQLEVREKRLQEQMQQLD
RENQELRAAVSLQAEKLQAERERGRAAAEDKARLTHVVAELQKQREVTQAAQRAVEEFQK
CLQALELGAAEKEGDYRSALRQLESMLEPLVQELEAARDPLGRKNQRSADVPDRLSAAEQ
KANTAPDAELLPGNSALEVQELRKKLQVLEGESCKAQELHRQQSAQLEQLAGELERKEEA
RAGLERLLKEMAPVQEELAGKGQEAAQLRRQLRESLGHLSSLEQELADVRQEERQRREEK
ELLEQEARSLARQLQLLETRVAQLSQLVGDLEEQKKQFIRDKDHLSQKVGMLEQLAVQRG
PDPPTAGEKPTAQGPPDSSLRQVFEKPEEEQRSPQEGQTGDTQMQGSGQEEKLQQANREL
EKELQNVLERNQLLEGKLQALQADYQALQQREATIRGSLASLESEQASIRHMGDQMEASL
LAVKKAKETMRAQVAKKEAALQNKETECQQLQEEVGRCRQLAEARERELRALESQCHQQT
QRIEALLAEQGQRGLGAPDDSAHQEPATPLALCQAQVETQQGEAGRLPAGVLDLQAKLQA
ALGDLEKVQGQLSVAEAALREHRALVQQLKEQNEALKKASGWEPLRRSEQERTEEEEEER
SRTESGSQEARLEQAEPPEQLPRASPANDEPSVHSCMQLTEKKQAEEALARALQELRDAK
EAASRQREGLEEQVAGLQRERDGLQERLKVAEEAARALPSLQAQLAQAEQRAQSLQETSH
EELNALKFQLSTEIMDHQSRLKTASEECRSLRDQLEERGRQLQAAEEAVERLKGQGSRQG
QEDRAAFGQPLGCRLSRGNRAPQASGLSASHFSTRTQKELEKATTKIQEYYNRLCQEVTD
REKNDQKMLADLDDLNRTKQYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTE
ASHCHDCKREFSWMVRRHHCRSAVRASGIWFCCSYSQHRPAEQEVGRCHYLYLVQRTGMV
ECTGRSISVSSSHSPSPPRAPSPSCASCPGVDADCRPPDDAVFDIITDEELCQIQESGSS
LPETPTETDSLDPNLPEPDTMSTSLTPEDTEDMPPGQDAEICLLKSGELMIKLPLTVDEI
ANFGESNRELFVRSSTYSVIPITVAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCK
VLIPTTRCSSHKENIQGQLKVRTPGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDF
L
Download sequence
Identical sequences M3YV29
ENSMPUP00000015189 ENSMPUP00000015189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]