SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015195 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015195
Domain Number 1 Region: 7-213
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-48
Family Pleckstrin-homology domain (PH domain) 0.00000322
Further Details:      
 
Domain Number 2 Region: 294-356
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000328
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015195   Gene: ENSMPUG00000015305   Transcript: ENSMPUT00000015434
Sequence length 363
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:2758552:3039952:-1 gene:ENSMPUG00000015305 transcript:ENSMPUT00000015434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVALPEEIRWLMEDAEEFLGEGLRNENLSATARDHRDHILRGFQQVKTRYYWDSQPQG
GDQAESYLGQDSSDDNQSGTHGPSLTSDAPFLPDYQDEGVEDLLKGAQELDNIIKQGYLE
KKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYSVRMAPYLRKDSKKE
SCFELTSQDRRSYEFTAANPAEARDWVDQISFLLKDLSSFTIPCEEEEEEEEEEETYDDI
DGFDAPNSGSQCRPVILPGSAGLKEPTKEREEDIYEVLPEEERDLEEDENGTPRKGVDYT
SYYQGLWDCHGDQPDELSFQRGDLIHILSKEYNVYGWWVGELNSLIGIVPKEYLTTAFEM
EEI
Download sequence
Identical sequences M3YV35
ENSMPUP00000015195 XP_004764797.1.14098 ENSMPUP00000015195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]