SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015198 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015198
Domain Number 1 Region: 38-343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-85
Family Protein kinases, catalytic subunit 0.000000000128
Further Details:      
 
Domain Number 2 Region: 311-331,406-527
Classification Level Classification E-value
Superfamily PH domain-like 9.72e-46
Family Pleckstrin-homology domain (PH domain) 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015198   Gene: ENSMPUG00000015308   Transcript: ENSMPUT00000015437
Sequence length 531
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:13521982:13560558:-1 gene:ENSMPUG00000015308 transcript:ENSMPUT00000015437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRTQTESSTAPGIPSGGSRQGPTMDSTAAAPRPSASSLQHTAQPPPQPRKKRPEDFKFG
KILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKL
YFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGKGIIHRD
LKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDL
WALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRL
GCEEMGGYGPLRAHPFFESITWENLQHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGC
MQVSSSSSSHSLSTADAGLPHTAGSNIEQYIHDLDTNSFELDLEFSEDEKRLLLEKQASG
NPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELR
PEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRYQSHPDAAVQ
Download sequence
Identical sequences M3YV38
ENSMPUP00000015198 XP_004750722.1.14098 XP_012910674.1.14098 ENSMPUP00000015198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]