SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015207 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015207
Domain Number 1 Region: 157-260,302-573
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-146
Family Myotubularin-like phosphatases 0.0000000612
Further Details:      
 
Domain Number 2 Region: 1061-1128
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.63e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 50-132
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000457
Family GRAM domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015207   Gene: ENSMPUG00000015317   Transcript: ENSMPUT00000015446
Sequence length 1146
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:13908506:13930923:1 gene:ENSMPUG00000015317 transcript:ENSMPUT00000015446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDTVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELTRMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNSDASEACDTDFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPGSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEETMDLYLSPATQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEARVGLEPWHSNPEESETFVES
GAGGPQQPVGEMGLPSSLPSSQKDYLSNKPFKNHRSCSPSYKLLSTAVPQEMKSNISDPE
IQVLEETTTPALDPPAHNELSRTSDGMEEPPEPCPEKEAVSALSQVASNKGHGVCDFPES
SQDSLTGAPQRALINSMLGAPSRCAPDHSLGTLCNPPSATCQTPPEPSTDFLSQDPPGSV
ASISHQEQPSSVPDLIHKEEYTGKRGNIRNGQLLENPRFGKVPLELSRKPVSQSQISEFS
FLGSNWDSFQGMVTSFPSGETTPRRLLSYGCCSKRSSNKQVSSTKPVPLSCPSPVPPLYL
DDDGLPFPTDVIQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDD
FTCLKESDGSDIEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWL
AKRRHHCRNCGNVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQHLKKP
IATASS
Download sequence
Identical sequences M3YV47
ENSMPUP00000015207 ENSMPUP00000015207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]