SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015264 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015264
Domain Number 1 Region: 352-417
Classification Level Classification E-value
Superfamily SH3-domain 3.65e-19
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015264   Gene: ENSMPUG00000015374   Transcript: ENSMPUT00000015503
Sequence length 419
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:3662554:3674135:1 gene:ENSMPUG00000015374 transcript:ENSMPUT00000015503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPALCKQVWVSHGEETKSSGVGWGGGQATNQEQGEAQNRRAPWGGSQRQGAMAELQQL
QEFEIPTGREALRGNHSSLLRVADYCVDNYVQATDKRKALEETMAFTTQALASVAYQVGS
LAGHTLRMLDLQAASLRQVEARVNTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAP
DSLPPLTPYYRRPLNFGCLDDIGHGIKDLTTQLSRTGTLSRKSIKAPATPASATLGRPPR
IPEPVLLPVVPEGKLSAASSASSLASAGSGEGVGGVSTTKGQAAPPPPPLPSPPAPPPPP
ASEVFLPPPLLEEVSLPLPAPELPPPLDLPPPPPPDLDELGLPLLPPPDFGPEEPSWVPA
SYLEKVVTLYPYTRQKDNELSFTEGTIICITRRYSDGWCEGVSSEGTGFFPGNYVQPSC
Download sequence
Identical sequences M3YVA4
ENSMPUP00000015264 XP_004764826.1.14098 ENSMPUP00000015264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]