SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015273 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015273
Domain Number 1 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-18
Family I set domains 0.042
Further Details:      
 
Domain Number 2 Region: 161-210
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 233-307
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000116
Family Pre-dockerin domain 0.075
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015273
Domain Number - Region: 494-548
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000369
Family Carboxypeptidase regulatory domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015273   Gene: ENSMPUG00000015383   Transcript: ENSMPUT00000015512
Sequence length 1171
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:5102615:5109502:-1 gene:ENSMPUG00000015383 transcript:ENSMPUT00000015512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSSGTWVSSFLAGKFTLNSGKELGTGETVARCQPAPTDSRAAARVPAHAVPAEASEWTS
WFNVDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWALPSTVGERVHLNPTRGF
WCLNREQPRGRRCSNYHVRFRCPLGEGGVWGRGLRGDSAEATWGAWGPWGPCSGSCGPGR
RLRRRRCPSPAGDACPGRPVEAQKCVRPTCPASLCPPGCSSKTCRCPEHILLGSVVTPSG
RPLPGARVSLRDWPGTTAITDAHGTFRMPGVCASSRANVSAQMDGFSAGLGQAQANGSIS
AVVTVVLNKLEKPYLVKHPESRVREAGQNVTFCCKASGIPLPKKYSWFHNGTLLDRREHR
YGAHLELRGLRPEQAGTYHCKAWNDAGAVRSGTAHLTVLAPGQPACNPQPREHLIKLPDD
CGQSGSGPTYLDVGLCPDTACPSPAGSSPRCGDTGSRCCSVRRLESREIHCSKYVLPVKV
VAECGCQKCLPPRGLVRGRVLASDSGEPLSFAQILLGQEPIGFTSYQGDFTLEVPPSTQR
LVVTFVDPSGEFMDTVRVLPFDPRGGGVYHDVKAMRKKAPVILEARESNTIPLGELEDEA
PLGELVLPAGAFRRADGEPYTGAVEARVTFVDPRDLTSAAAAPSDLRFADSDGELAPLRT
YGMFSVDLRAAGSAEQLQAGPVAVRVNAGQIRMAGHAEALKLWSLNPDTGLWEEESGFQR
EGSAAPRVRREERVFLVGNVEIRERRLFNLDVPERRRCFVKVRAYANDKFTPSEQVEGVV
VTLVNLEPAPGYSANPRAWGRFDSAVTGPNGACLPAFCDEDRPDAYTALVTATLGGEELE
PAPSRPRPLAATVGVAQPYLDRLGYRRTDHDDPALKRNGFRINLAKPRPGDPAEANGPVY
PWRSLRECQGAPVTASHFRFARVEADKYEYNVVPFREGAPASWTGDLLAWWPNPQEFRAC
FLKVKIQGSQEYMVRAHNAGGSHPRTQGQLYGLRDARSVRDPQRPGTSAACVEFKCSGML
FDQRQVDRTLVTIMPQGSCRRVAVNGLLRDYLARHPPPAPADDPAAFSMLAPLDPLGHNY
GVYTVTDQSPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLL
EAPATALGDIRREMGQAARAQAQTTGRLRTR
Download sequence
Identical sequences M3YVB3
ENSMPUP00000015273 ENSMPUP00000015273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]