SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015291 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015291
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-17
Family PDZ domain 0.0000948
Further Details:      
 
Domain Number 2 Region: 195-249
Classification Level Classification E-value
Superfamily EF-hand 0.0000731
Family Calmodulin-like 0.051
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015291
Domain Number - Region: 261-301
Classification Level Classification E-value
Superfamily BAG domain 0.0863
Family BAG domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015291   Gene: ENSMPUG00000015401   Transcript: ENSMPUT00000015530
Sequence length 522
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:16838174:16923649:-1 gene:ENSMPUG00000015401 transcript:ENSMPUT00000015530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITVTKETGLGLKILGGINRNEGPLVYIQEIIPGGDCYKDGRLKPGDQLVSINKESMIGV
SFEEAKSIITRAKLRSESVWEITFIRQKSDGSHPGNPSCTSLLQASGEYGPQVSTFSLLP
SPPETLIPKTSSTPQTTDTILPSFRINQMKTGYKKTEQTPITSSGNSPTDMSNTDIAPAW
TDNYGPQGKKISLNPSVRLKAEKLEMALDYLGIQPTKEQHQALRQQVQVDPKGTVSFGDF
VQVARNLFCLQLDEVNVSAREISSILDSQLLPCDSLEADEIERLKRERNDALEEVNMLKE
KLFESERQKKQLAEELQNVKQEAKAVVEETRALRSRIHLAEAAQRQAHGMEMDYEEVIRL
LEAEVTDLKAQLADYSDQNKESVQELKKRITVLDCQLRKSEMARKTFEASTEKLLHFVET
IQELFSDNTSPLSNLSERRAMLASQTSLTPLGRNGRNIPAMLALESKELVKSVRAILDMD
CKFSAIFHFLFFFFFFSNLFNRTKRNFKLDSLILLNVLVCLQ
Download sequence
Identical sequences M3YVD1
ENSMPUP00000015291 ENSMPUP00000015291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]