SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015308 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015308
Domain Number 1 Region: 484-591
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-23
Family PDZ domain 0.0000626
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015308
Domain Number - Region: 664-770
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00262
Family Myosin rod fragments 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015308   Gene: ENSMPUG00000015418   Transcript: ENSMPUT00000015547
Sequence length 820
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:4396723:4575683:-1 gene:ENSMPUG00000015418 transcript:ENSMPUT00000015547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPEAPGPDEAPKAAHHKKYGSNVHRIKSM
FLQMGTTAGPPGEAGGGAGPTEALRAPERGVRLSLPRASSLNENVDHSALLKLGTSVSER
VSRFDSKPAPSAQPAPPPHPPSRLQETRKLFERSVPATAGSDKEAAARRLLRQERAGLQD
RKLDVVVRFNGSTEALDKLDADAVSPTVSQLSAVFEKADSRTGLHRGPGLPRAAAAGAPQ
VNSKLVSKRSRVFQPPPPPPPPAPSGDAPGEKERGPAGQQPPQHRVAPARPPPKPREVRK
IKPVEVEESGESEAEAAPGEVIQAEVTVHAALENGSALATTASPAREEQKAQAAPEEATA
TVAAPERGVGNGRAPDVAPEEADESKKEDFSEADLVDVSAYSGLGEDSGGSALEEDDEED
EEDGEPPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFSTYSNEDYDRRNEDVDPM
AASAEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAA
HRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQ
TLEQERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFPGGEMAIEVFELAENEDAL
SPVDMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKGRWRVEKAQLEQSVEENK
ERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKET
AQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST
Download sequence
Identical sequences M3YVE8
ENSMPUP00000015308 XP_004764867.1.14098 ENSMPUP00000015308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]