SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015325 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015325
Domain Number 1 Region: 617-685,937-1273
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-119
Family Ras GEF 0.0000105
Further Details:      
 
Domain Number 2 Region: 222-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-43
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 21-128
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-19
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 432-586
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000263
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015325   Gene: ENSMPUG00000015435   Transcript: ENSMPUT00000015564
Sequence length 1276
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896996.1:226098:312422:-1 gene:ENSMPUG00000015435 transcript:ENSMPUT00000015564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVASLGLLARQDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSGKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRRQIEDGETEIERLKAEIAS
LLKDNERIQSTQTTTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRR
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEDPENTEEDAKGAN
QDIDHLDFKIGVEPKDSPSFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYRKPISAIPASSGHASRGPAGHREPWVPARSLELLFASG
QSNKLLYGDPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSC
SSNGYTSLYSAVSPFSKATLDTSKLYVSSSLANKIPDEGDTAAEKPEEPVALSKQTSEVS
VREESDNDQNQSDDGDPEVSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVVTSCRELDSTR
SALSAASAFAIATAGANEGAPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNV
LRHWVSKHSQDFETNDELRCKVVSFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQI
TLEEITQLAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTP
YIMKTTKHFNDISNLIASEIIRNEDINARVSTIEKWVAVADICRCLHNYNAVLEITSSMN
RSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDL
AFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQVKVTQYLLDRSFVMDE
DSLYESSLRMEPKLPT
Download sequence
Identical sequences M3YVG5
ENSMPUP00000015325 ENSMPUP00000015325 XP_012917476.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]