SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015361 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015361
Domain Number 1 Region: 396-539
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 292-397
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-35
Family Second domain of FERM 0.000000932
Further Details:      
 
Domain Number 3 Region: 211-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-26
Family First domain of FERM 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015361   Gene: ENSMPUG00000015472   Transcript: ENSMPUT00000015601
Sequence length 853
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:17974762:18076779:-1 gene:ENSMPUG00000015472 transcript:ENSMPUT00000015601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENSQHQQQKEEGEGATNSGQQETQLEEASQEAAEGDNQCEQKLKTSNGD
TPTHEDLTKNKERTSENRGLSRLFSSFLKRPKSQVSEEEGKDVESAKEKCEGGQKEIEFG
TSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEEHREDPDFETKEGGDLEEC
SKIEVKEESPESKAESELKASQKSIRRHRNMHCKVSLLDDTVYECVVDKHAKGQDLLKRV
CEHLNLLEEDYFGLAIWDNANSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTED
ITRYYLCLQLRQDIVAGHLPCSFATLALLGSYTIQSELGDYDPELHGADYVSDFKLAPNQ
TKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSG
LLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKV
CVEHHTFFRLTSTDTLPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRA
SRSLDGAAAVDSDRSPRPTSAPAIAQSQDTEVSKAQKETVKVEEQKEEVPPGQAEPEPTE
AWKVEKTHIEVTVPTSNGDQTQKLAEKTEDLIRMRKKKRERLDGENIYIRHSNLMLEDLD
KSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQLPTGEGPPLV
KTQTVTISDTATAVKSEIPTKDVPIVHTETKTITYEAAQQTDDSNGDLDPGVLLTAQTIT
SETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVT
KVVVHQETEISEE
Download sequence
Identical sequences M3YVK1
ENSMPUP00000015361 ENSMPUP00000015361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]