SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015371 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015371
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.08e-55
Family ENTH domain 0.000000667
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015371   Gene: ENSMPUG00000015482   Transcript: ENSMPUT00000015611
Sequence length 635
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:4720584:4726403:1 gene:ENSMPUG00000015482 transcript:ENSMPUT00000015611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSALRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFAEVMGML
WRRLNDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQG
VNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGTGIGSGQLGLGRSRGSPSSYNS
SSSSPRYTSDLEQARPQTSGEEELQLQLALAMSREEAEKPVPPASHRDEDLQLQLALRLS
RQEHEKEVRSWRGEDSPVANGAGALVRHWQDKEPEREERKEEEKLKTSQSSILDLADIFA
PTPAPPSTHCSADPWDIPGLRPNTEPSGSSWGPSADPWSPVPSGSTLSRSQPWDLPPMLS
SSEPWGRTPVLPARPPSTDLWAQNSPQHKLPNTGADPWGTSVEISSAPALGGTSPFDPFA
KPPVSTETKEGPECAQALPSGKPGSPVELDLFGDPIPSSKQNGTKEPDAFDLAVLGETLT
QPSQEARACRTPESFLGPSASSLVNLDSLVKAPQAAKTRNPFLTGLSAPSPTNPFGAGEQ
GRPTLNQMRTGSPALGLAASGPVGAPLGSMTYSASLPLPLSSVPAGVTLPASVSVFPQAG
AFTPPPNTPPQPLLPTSGSAGPLQLPPQAGTNPFL
Download sequence
Identical sequences M3YVL1
ENSMPUP00000015371 ENSMPUP00000015371 XP_004764891.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]