SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015376 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015376
Domain Number 1 Region: 1558-1856
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.18e-74
Family Rap/Ran-GAP 0.00035
Further Details:      
 
Domain Number 2 Region: 138-325,364-694
Classification Level Classification E-value
Superfamily ARM repeat 7.82e-21
Family Armadillo repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015376   Gene: ENSMPUG00000015487   Transcript: ENSMPUT00000015616
Sequence length 1906
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:13948439:13980767:-1 gene:ENSMPUG00000015487 transcript:ENSMPUT00000015616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMTNFCALHIPAAPAARHVTRSSLRLSARELPGTTTPGKLVRGARALCAAGSADRASGG
GSGLGVGPGWLSFLPAGTARRPVPEAASGAFLSAMAKPTSKDSGLKEKFRNLLGLGTPRP
NPRSAEGKQTEFIITADILRELSVECGINNRIRVIGQICEVAKTKKFEEHAVEALWKAVA
DLLQPERPPEARHAVLALLKAIVQGQGDHLGVLRALFFKVIKDYPSNEDLHERLEVFKAL
TDNGRHITYLEEELAGFVLQWMDIGLSSEFLLVLVNLVKFNSCYLDEYIASMVHMICLLC
VQTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFIVTLCRTINVKELCEPCWKLMRNLLGT
HLGHSAIYNMCRIMEDRAYKEDAALLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEA
MTCPNEVVSYEIVLSITRLIKKYRRELQAVTWDILLTIMERLLQQLQSLDSPELRAVVHD
LLTTVEELCDQSEFHGSPERYFELVERCADQRPESSLLNLITYRAQSIHPAKDGWIHNLQ
LLMERFFRNESRSAVRIKVLDVLSFVLLINRQFYEEELISSVVISQLSHVPEDKDPQVRK
LATQLLVDLAEGCHTHHFNSLLDIVEKVMSRSLSPPAELEERDVAAYSASVEDVRTAVLG
LLVILQTKLYSLPASHAMRVYETLVGHIQLHYKHDYTLPIAASIRLQAFDFLLLLRADSL
HRLGLPSKDGAVRFSPYCVCDAMEPERGPEKKASGTLSNPTGPPGPAPTGPAVRLGSLPY
SLLFRVLLQCLKQEADWKVLKLVLGKLPESLRYKVLIFTSPCSVDQLSAALCSMLSGPRT
LERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQGLIYRCASQCVV
ALAICSVEMPDIIIKALPVLVVKLTHISATASMAVPLLEFLSTLARLPHLYRNFAAEQYA
SVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPFITKGLRSNVLLSFDD
TPEKDSFRARSTSLNERPKSLRIARTPKQGLTNSPPVKECKESSAAEAFRCRSISVSEHV
VRRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPV
GEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQGGPELSTDAGVHVRQTKE
APAKLESQAGQQVCRGARDRVRSMSGGHGLRVGTLDTPASHFAGGPTSPGAQTAPASKPE
RASAGTQFPAQEKTSLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMP
LQELSNALMAAERFKERRDTALYKSLSVPAAGSAKPPPPPRSNTVASLSSLCQSSCRAQL
HRGVSWADSAVVPEEGSPSEARLPTEPTELEDFEATLGTDRRSGRAEAYSRSSSSSSQEE
RFPAEEPAAGGVPIERAVSSEGARPSAELPFQPCQPLSKSSSSPELQTLQDILGDPGDKT
DVGRLSPEAKTRSQSGILDGAGAAWSAPGEESQGRGPTQPEGPLPSSCPRSPSGLRPRGY
TISDSAPSRRGKRVERDAFKSRTGASNTEKVPGINPSFVFLQLYHSPFFGDESNKPILLP
NESFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTGLGKLIE
LKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGN
DFVSIVYNDSGEDFKLGTIRGQFNFVHVIITPLDYECNLVSLQCRKDMEGLVDTSVAKIV
SDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRHRIQEEAQYSSP
SLPLLQTHTPGHGKAPAPAPAEPVPAYETGQRKRLISAVDDFTEFV
Download sequence
Identical sequences M3YVL6
ENSMPUP00000015376 ENSMPUP00000015376 XP_012910688.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]