SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015428 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015428
Domain Number 1 Region: 17-136
Classification Level Classification E-value
Superfamily PX domain 2.22e-26
Family PX domain 0.00066
Further Details:      
 
Domain Number 2 Region: 230-285
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000127
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 163-227
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000184
Family SH3-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015428   Gene: ENSMPUG00000015539   Transcript: ENSMPUT00000015669
Sequence length 370
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:14038583:14040690:1 gene:ENSMPUG00000015539 transcript:ENSMPUT00000015669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRYPVSVCAAALVQTARHQTFAFSVCWSDGSDTFVRRSWEEFKKLHKNLKDTFPVEA
GLLRRSDRVLPKLRDASLLVRGGRTGRGLARLRLLETYSRTLLTMAARVSQSSALSDFFA
PQPLDLEPRLPAGSLVILPAPEEPLGRPTDTLAIHGLEAQSLRCLEPFSTQDMQGRPFHT
RAQEVLDVLLRHSSGWWLVVNEDQQTAWFPAPYLEEAAPGPQQQPLGSRGSQFCASQAYE
SSHADELSVPAGARVRVLEMSDRGWWLCRFGGRCGLLPAVLLRPEGLGALLSGSGLHRQE
DSEEARVGDPQRPPEIPQGTTLTPMVPAHPPLSAIQTRCCTITRRALARKYPLQGVWSCA
EGRPKAPDPG
Download sequence
Identical sequences M3YVR8
ENSMPUP00000015428 ENSMPUP00000015428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]