SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015445 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015445
Domain Number 1 Region: 46-174
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-48
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000225
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015445
Domain Number - Region: 180-374
Classification Level Classification E-value
Superfamily Tropomyosin 0.000111
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015445   Gene: ENSMPUG00000015556   Transcript: ENSMPUT00000015686
Sequence length 386
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896996.1:3256923:3384421:1 gene:ENSMPUG00000015556 transcript:ENSMPUT00000015686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSLPCRAFRGLLPPASPCFPLTVGNSPSESPTPPVVPGCALPREQPIFTTRAHVFQID
PSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKTSQKFGQW
ADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAARLARDKSQEKIETSSNHSQVSSVNGTD
DEKASHVGPADAQLKSENDKLKIALTQSAANVKKWEMELQTLRESNARLTTALQESAASL
EQWKRQFSVCRDENDRLRNKIDELEEQCSEINREKERNTQLKRRIEELESELREKETELK
DLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKS
FLEVLDGKIDDLHDFRRGLSKLGSDN
Download sequence
Identical sequences M3YVT5
XP_004763725.1.14098 ENSMPUP00000015445 ENSMPUP00000015445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]