SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015485 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015485
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0049
Further Details:      
 
Domain Number 2 Region: 312-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.5e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015485   Gene: ENSMPUG00000015595   Transcript: ENSMPUT00000015726
Sequence length 532
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896953.1:1553390:1587339:1 gene:ENSMPUG00000015595 transcript:ENSMPUT00000015726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRVAIIGAGVSGLASIRSCLEEGLEPTCFERSEDVGGLWKFSDHAEEGRASIYQSVFT
NSSKEMMCFPDFPYPDDFPNFMHNSKLQEYITAFSKEKKLLRYIQFKTLVSGINKRPDFS
VTGQWDVTTERDGKKESAVFDAVLVCSGHHVYPNLPKESFPGLKLFKGKCFHSRDYKEPG
IFKGKRILVMGLGNSGCDIATELSHTAEQVIISSRSGSWVMSRVWDDGYPWDMVFITRFE
TFLKNNLPTAISDWWYMKQMNARFKHENYGLMPLNGTLRKEPVFNDQLPACILCGTVSVK
PNVREFTETSAIFEDGTVFEAIDCVIFATGYSYDYPFLDESIIKCKNNEVTLFKGIFPPK
LEKPTMAVIGFVQSLGATIPTADLQARWAVQVIKGTCTLPSVTDMMNDIDKKRGKKLKWF
GTSETVQTDYITYMDELASFIGAKPNIPWLFLTDPKLAVEVFFGPCSPYQFRLVGPGKWP
GARHAILTQWDRTLKPTKTRAAGTPQKPCLLCRWARLLILPALFIAVFFALI
Download sequence
Identical sequences M3YVX5
ENSMPUP00000015485 ENSMPUP00000015485 XP_004756746.1.14098 XP_004756747.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]