SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015492 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015492
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.78e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.002
Further Details:      
 
Domain Number 2 Region: 312-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000168
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015492   Gene: ENSMPUG00000015602   Transcript: ENSMPUT00000015733
Sequence length 539
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896953.1:1634648:1659458:1 gene:ENSMPUG00000015602 transcript:ENSMPUT00000015733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLVSLKCCVDEGLEPTCFERTEDIGGLWRFKENVEEGRASIYQSVIT
NTSKEMSCFSDFPMPEDFPNFLHHSKLLEYFRIFARKFDLLKYIQFQTTVLSVKKHPDFS
SSGQWEVVTECNSKKQSAVFDAVMVCSGHHILPHMPLGSFPGIERFKGQYFHSHQYKHPE
GLEGKRILVIGLGNSASDIAVELSKKAAQVFVSTRHGSWVMGRISEGGYPWDMVFHTRFR
SMLRNVLPQMIRKWMMEQQMNQWFNHENYGLEPQNKYLMKEPVLNDDLPSRILYGAIKVK
PTVKELTETSAIFEDGTVEEKIDVIVFATGYTFSFPFLEDALVKVEDKMVSLYKYMFPPH
LEKSTLACIGLIQPLGSIFPTVELQARWATRVFKGLCTLPSERTMMADIIQRNEKRIDLF
GKSQSQTLQTNYIDYLDELAAEIGAKPDILSLLLKDPRLAVKLYFGPCNSYQYRLTGPGP
WQGAKSAILTQKQRILKPLKTRAVKASRDFPVSFLLKILGLLAIVVAFVFSLSGSNLSA
Download sequence
Identical sequences M3YVY2
XP_004756748.1.14098 XP_004756749.1.14098 ENSMPUP00000015492 ENSMPUP00000015492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]