SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015507 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015507
Domain Number 1 Region: 270-400
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.84e-38
Family Synaptotagmin-like (S variant) 0.0013
Further Details:      
 
Domain Number 2 Region: 401-537
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.56e-27
Family Synaptotagmin-like (S variant) 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015507
Domain Number - Region: 41-79
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00978
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015507   Gene: ENSMPUG00000015617   Transcript: ENSMPUT00000015748
Sequence length 569
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:19431751:19437738:-1 gene:ENSMPUG00000015617 transcript:ENSMPUT00000015748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALSQLMPQRGHPFQERLWALPSRLMAHGPQPEADALLDLSFLTEEEQEAIADVLKRDAR
LRQLEEGRVSKLRASLADPGQLKILTGDWFQEARSQRHHHAHLGSDLVRASIRRKKSSMG
TGDQAPGSDGEAEAAEKEVEEEPEPRLVVDKAPQETLSKAEKPDSPSPYVPLKSSDHEEE
PQSQEAPGSGAPQVYTEEADPEPEPRPRGAESPPPPGQTQTAPEILQNGEEAPGPSPSLD
RMLSSSSSVSSLNSSTLSGSLLSLSGEAEAGAVQVRGSVHFGLRYEPGTAELRVHVIQCQ
GLAAARRRRSDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQAELRGRVLSLS
VWHRESLGRNIFLGEVEVPLDTWDWDSEPTWLPLQPRVPHSPDDLPSRGLLSLSLKYVPA
GSEGAGLPPSGELHFWVKEAQDLVPLRSGTPDTYVQCSVLPDDSHASRQRTRVVRRSLSP
VFNHTMVYDGFRPADLHQACAELSLWDHGALTSRQLGGTRLSLGTGSSYGLQVPWMDSTA
EEKQLWQMLLERPCEWVDGLLPLRTDLVP
Download sequence
Identical sequences M3YVZ7
ENSMPUP00000015507 ENSMPUP00000015507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]