SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015557 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015557
Domain Number 1 Region: 982-1095
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-24
Family Synaptotagmin-like (S variant) 0.0068
Further Details:      
 
Domain Number 2 Region: 158-198,225-269,311-349
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.32e-22
Family Synaptotagmin-like (S variant) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015557   Gene: ENSMPUG00000015667   Transcript: ENSMPUT00000015798
Sequence length 1157
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:14539913:14548433:-1 gene:ENSMPUG00000015667 transcript:ENSMPUT00000015798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPTMTTLLEIKSSVLRQVQVRPSFRRRTEGEPGSTGADPQEPTAAGAWKPGDGVEFFAH
MRLILKKGEGRQGLPCPEVLLRSGSPAPAEPVDPSRGLRALTQEEVEMLYEEALYTVLYR
AGTMGPDQVDDQETLLGYLQQVFGTSSDEHAKAIERVKKAKAPTYALKVSVMRAKNLLAK
DPNGFSDPYCMLGILPASGAPREPGPHKEQRFSFRKGSKRGGPLPAKCIQVTEVKSSTLN
PVWKENFFFEIEDVSTDQLHLDIWDHDDDVSLVEACRKLNEVIGLKGMSRYFKQIVKSAR
ANGTAGPTEDHTDDFLGCLNIPIREVPVAGEDRWFKLEPRSSASRVQGDCQLVLKLITTQ
RDTGMSQRGRSGFLSYMLLLSRLLQFEHRSQEPDSSSWRGELSGPAATVLCLHGAQSNLS
SLQLAVLHWQVSSRHHQTCTLDYGYLLGLLEDLQAHWEEASSLPQDQEESLVDSFSAFSE
FGLRLLRQLRDYFPATNSTAVYRLELLLKCLSKMQLFQPSFESCPFETELNMDIAAALKR
GNREWYDRLLNSKSPREQPGPQRLAGLVHLADTVYEDLQSCYGVYASLFHSIVEIDFFTL
TFRQLERLVAEEAWVLTEELSPKLTLEVASGLFELYLTLADIQGFWSSLPGRDSRSLALA
GIHAPFLPAVKLWLQVLRDQTRCRLQGAVDVDTLEPTDASSKHSSSAATASLCFSHIQEL
WARLAWPDPAQAQALGTQLSQDLCEATLFYTELLRKKVDAQPGAAGEAVSEPLCVVLNNV
ELLRKAAGQALRGLAWPEATLALEGGLPRPLLSCMQALDEDLQQEVQTVTAHLTSKMVAD
IRKYVQHISLSPDSIQNDEAVAPLMKYLDEKLALLNTVLVKENLSRVLEALWELLLQAIL
QALGANLDVSADFYGRFHFALEALVNFFHAEGQGLPLESLRDGSYKRLEEELRLHQCSTR
ECIEQYYLDKLKQRSLEQNRFGRLSVRCHYEAAEQRLVVEVLHAADLPPLDANGLSDPFV
IVELGPPHLFPLVRSQRTQVKSRTLHPVYDELFYFSVPAEACRRRGACVLFTVMDHDWLS
TNDFAGEAALSLGSIGGIARPQVGGSSRARQPVTLHLRRPRAQVKSALRMLEGRTNKEAQ
EFVKKLKELEKSMEADP
Download sequence
Identical sequences M3YW47
ENSMPUP00000015557 ENSMPUP00000015557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]