SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015618 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015618
Domain Number 1 Region: 611-716
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 321-425
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-29
Family SH2 domain 0.00000237
Further Details:      
 
Domain Number 3 Region: 105-261
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-17
Family BCR-homology GTPase activation domain (BH-domain) 0.00027
Further Details:      
 
Domain Number 4 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000024
Family SH3-domain 0.0000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015618   Gene: ENSMPUG00000015727   Transcript: ENSMPUT00000015859
Sequence length 726
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:6189085:6198171:-1 gene:ENSMPUG00000015727 transcript:ENSMPUT00000015859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSESLYRPELPAPRTDWSLSDVEQWDSAALTDGVKGFLLA
LPAPLVTPEAVAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPAPG
PAVRALGATFGPLLLRAPPPSPPPGGAPDGTESSPDFPVLLVEKLLQEHLEEQEVAPPAL
PPKPPKAKPAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQ
GEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLL
YPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIE
AFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKL
EQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETE
DQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVD
GDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPG
PPPPAR
Download sequence
Identical sequences M3YWA8
XP_004761018.1.14098 ENSMPUP00000015618 ENSMPUP00000015618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]