SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015621 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015621
Domain Number 1 Region: 144-453
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-99
Family Protein kinases, catalytic subunit 0.0000000000838
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-22
Family Pleckstrin-homology domain (PH domain) 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015621   Gene: ENSMPUG00000015730   Transcript: ENSMPUT00000015862
Sequence length 488
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896953.1:7197594:7520420:-1 gene:ENSMPUG00000015730 transcript:ENSMPUT00000015862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVTVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKSAGGVLDCCPRTTTLLCPDLAEGRRRTSS
TPTSRGTV
Download sequence
Identical sequences M3YWB1
ENSMPUP00000015621 ENSMPUP00000015621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]