SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015653 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015653
Domain Number 1 Region: 429-573
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 254-364
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000027
Family PDZ domain 0.025
Further Details:      
 
Domain Number 3 Region: 96-153
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000628
Family SAM (sterile alpha motif) domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015653   Gene: ENSMPUG00000015762   Transcript: ENSMPUT00000015894
Sequence length 791
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:20339711:20354266:-1 gene:ENSMPUG00000015762 transcript:ENSMPUT00000015894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGETVPTSFGPGLGEWMASPSIKELVREDLPLTLTSKPLPPAPALGGGGGGCFCYFCLQ
GLGCLFPTWSSFGTYSLAFPRGSCILAGDPKWNPGLDDSLQHYCFEDWELPGKYLLQLCP
RSLEALTVWPLGHQELILEGVEQLRALSSGLQTENLQSLTEGLLQRTYAFQSLVQGHLEG
CAKPPADVLSAAVELVHEARTLLFWLNRYLFSHLNDFSACQKIGELCGELGQALQEDSPA
AERESQVLRICSHVAGICHHILRCSPQELLEQRALLERVQLDDPLGLEIHTTGNCLHFVS
RVGPQVAADSPLQILPGDEIVQVNEQVVVGWPHKNVLRELLREPAGVSLVLKKVPVPKTP
PQTLAQTPGSAPLSSPLLAFTPLSPRAPSEDVFAFDLTSDPSPAPSPTWTDSTSLDLESR
PIHPAPLATYPAGVAETQEAPEQPDTSPVSGRKKSKGVATRLSRRRVSCRELGQPDCDGW
LLLRKVPGGFMGPRWRRCWFVLKRHTLYWYRQPQDEKAEGLINVSNYSLESGQDQKKKYV
FQLTHDMYKPFIFAADTLEDLSMWVRHLITCISKYQSPGRASLPREEDCYSETEAEDPDD
EAGSRSASPSPAQVWSPLHGDTSPAATPTQGSPRTSFGPPSDSSEGALEGMVQGLRQGGV
SLLGQLQPFTHEQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQALEEVLGDPEL
TGEKFRQWKEQNQELYSEGLGGWGVVQPEGPSQVPSSDSREQSSHPLPSDPEEQSHLCPL
TPESNLRPPDL
Download sequence
Identical sequences M3YWE3
ENSMPUP00000015653 ENSMPUP00000015653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]