SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015670 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015670
Domain Number 1 Region: 30-179
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-43
Family Phosphotyrosine-binding domain (PTB) 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015670   Gene: ENSMPUG00000015779   Transcript: ENSMPUT00000015911
Sequence length 309
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:20857035:20879860:-1 gene:ENSMPUG00000015779 transcript:ENSMPUT00000015911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALKSAGRALIRSPSLAKQSWGSGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQ
PKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDNITNQLIENVSIYRISYCT
ADKMHDKVFAYIAQSQHNENLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQMSKEEKE
KREKASQEGGDVLGGGLRDSTPSLKSLVATGNLLDLEETAKAPLSTVSANTTNVDEAPRP
QGLNNSSVVWELDDGLDEAFSRLAHSRTNPQVLDTGLTAQDIHYAECHSPVNWDKPDGRR
AEQDDLFSF
Download sequence
Identical sequences M3YWG0
XP_004741194.1.14098 ENSMPUP00000015670 ENSMPUP00000015670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]