SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015689 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015689
Domain Number 1 Region: 811-1094
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-69
Family Protein kinases, catalytic subunit 0.00000582
Further Details:      
 
Domain Number 2 Region: 496-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-41
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 3 Region: 374-477,514-538
Classification Level Classification E-value
Superfamily SH2 domain 1.51e-16
Family SH2 domain 0.0038
Further Details:      
 
Domain Number 4 Region: 264-362
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000934
Family Third domain of FERM 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015689   Gene: ENSMPUG00000015797   Transcript: ENSMPUT00000015930
Sequence length 1107
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:6411742:6429387:1 gene:ENSMPUG00000015797 transcript:ENSMPUT00000015930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSYGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDSSTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAVLDLPVLEHLFAQHRNDLVSGRLSVGLSLKEQGECLSLAVLDLARMAREQVQQ
PEEMLKTVSYKVCLPPDLRDLIQGLSFVTRKRIRRTVRRALRRVTACQADRHSLMAKYIM
DLERLDPARAVETFPVNLPGAAGGEDAKGLLRVAGDSGIAWSSGGQEALQPFCDFPEIVD
ISIKQAPCVGPAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGYFRLISDSRHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTQGSRPGSYVLRRSPQDFDCFLLTVCVQTP
LGPDYKGCLIRCDPTGTFSLAGLGRPHSSLRELLAACWNGGLHVDGVALSLTFCCTPKPK
EKSNLIVVRRGCSPPTSSPLQTQSQGQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVEGEARKTEVLLKVMNAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFAHLGALDTYLRKSGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLARKGA
DGNLPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLLEPRTLGLEADKWGFGATVWEVFS
GIPIPISTLDPAKKLQFYKEQQQLPAPKWMELAMLIQQCMVYEAGQRPSFRAIIRDLNSL
ITSDYELLSDPTPGALTPRDGLWNGAQLYAYQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQKDFQREIQTLKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDANRLLLYASQICKGMEYLGSRRYVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVHKPGQSPIFWYAPESLSDNIFSRQSDVWSFGVILYEL
FTYGNKSCSPSAEFLRMMGMMGCDRDVPALCCLLELLAEGQRLPAPAACPGEVHELMKLC
WASSPKDRPTFSALGPQLDALWSASRG
Download sequence
Identical sequences M3YWH9
ENSMPUP00000015689 XP_004761047.1.14098 ENSMPUP00000015689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]