SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015696 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015696
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.7e-62
Family RUNT domain 0.000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015696   Gene: ENSMPUG00000015804   Transcript: ENSMPUT00000015937
Sequence length 412
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:21374578:21403353:1 gene:ENSMPUG00000015804 transcript:ENSMPUT00000015937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAV
MKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKL
EDQTKPFPDRFGDLERLRMRVTPSTPSPRGSISTTSHYSSQAQTPIQGGQSCSWPPPDDF
QGYSAQTWDRPTLSWGSPSSDTPLSLVSTPLNSFDPLALAASETGQLGIRHMSGLSTSDL
NPFSDPRQFDRSFPALQTFTESRFPDPRMHYPGAMPAAFPYSATPSGSLSVASMPTTGRF
HHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGASSGSYQFSMVAGSSSSGGERSPTRMLA
SCTSSASVAAGNLMNPSLGGQSDSVEADGSHSNSPTALSTPGRMDEAVWRPY
Download sequence
Identical sequences M3YWI6
ENSMPUP00000015696 ENSMPUP00000015696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]