SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015699 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015699
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.7e-56
Family FCH domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015699   Gene: ENSMPUG00000015807   Transcript: ENSMPUT00000015940
Sequence length 887
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:6465222:6488294:-1 gene:ENSMPUG00000015807 transcript:ENSMPUT00000015940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYFGEHFWGEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASN
GTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKLHKKCKEEAVGT
LDAVQVLAGVSQLLPKSRENYLNRCMDQERLRRENTSQKEMDKAETKTKKAAQSLRRSVE
KYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNI
ENVSVEMLLRKFAESKGTGREKPGPLDFETYSAAALQEAMKRLRGAKAFRLPGLSRRERE
PPAAVDSLEPDSGTCPEVDEEGFTVRPDVTQNSTVEPARFSSSDSDFDDEEPRKFYVHIK
PAPARAPACSPDVAAAQLRATAGSLILPPAPGGTMKRHSARDAAKKPQRPRSAPRASSCA
EKLQSDEQFSKNLFGPPLESAFDHEDFTGSSSLGFTSSPSPFSSSSPENVEDSGLDSPSH
VAPGPSPDSWVPRPGTPQSPPSYRAPASESRGTRSLPASDSPQPLAPSPGPWGLEAVAGR
DLVPGPADPAAREGLAAPPRRARARKVSCPLTRSNGDLSRSLSPSPLGSSTTSTLSDRPS
FSSQTAHGVSRGPSPVVLGSQDALPVATAFTEYVHAYFRGHNPSCLARVTGELTMTFPAG
IVRVFSGTPPPPVLSFRLVHTSAIEHFQPNADLLFSDPSQSDPETKDFWLNMAALTEALQ
RQAEQNPTASYYNVVLLRYQFSRPGPQSVPLQLSAHWQCGATLTQVSVEYSYRPGATAVP
TPLTNVQILLPVGEPVTNIRLQPAATWNLEEKRLLWKLPDVSEAGGSGHLSASWEPCSGS
STPSPVAAQFTSEGTTLSGVDLELVGSGYRMSLVKRRFATGMYLVSC
Download sequence
Identical sequences M3YWI9
XP_012916178.1.14098 XP_012916179.1.14098 XP_012916180.1.14098 XP_012916182.1.14098 XP_012916183.1.14098 XP_012916184.1.14098 XP_012916185.1.14098 XP_012916186.1.14098 XP_012916187.1.14098 ENSMPUP00000015699 ENSMPUP00000015699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]