SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015709 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000015709
Domain Number - Region: 190-245
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000102
Family PLC-like (P variant) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015709   Gene: ENSMPUG00000015817   Transcript: ENSMPUT00000015950
Sequence length 410
Comment pep:novel scaffold:MusPutFur1.0:GL896953.1:9969927:9978736:-1 gene:ENSMPUG00000015817 transcript:ENSMPUT00000015950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLVAEANQMGEELDKGLRMELKVKNLASSDSRGYDLQKEVMVKVTHQRTHEVWIWSKAK
FINRKFLMEELYQRFLEGEASHVAREDDPFWDPVEAVHLGSAHVWLQPLAYCMRLEEQVD
FLNCDGTEEAVLHVHVTPCSPGGQACGDEDVVMDPLELLGKRMDFQIGLVRCLGIKWLKE
RAERGVQIGYRIYDLSSTFYTKPVWKTVNPQIEETVQFTALNASQEFLNYLQTNALVVEL
WGLQEGCTQLSSSQPDVMVTSEGHIMVDTKKISTVMDTSQTTSNQISELYMKLLKLEQET
ELLRNVNRALREENVLLKHSLQKVASAKPARKPSDTLKVPPMPAQLPAAGDSPHVSAQRA
GSDRELAMALKVFYQSMNAARGQFLRLKHYKPPMESKKVKNSQDQDPKTS
Download sequence
Identical sequences M3YWJ9
ENSMPUP00000015709 ENSMPUP00000015709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]