SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015716 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015716
Domain Number 1 Region: 686-825
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-32
Family Synaptotagmin-like (S variant) 0.052
Further Details:      
 
Domain Number 2 Region: 19-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-27
Family PLC-like (P variant) 0.000000532
Further Details:      
 
Domain Number 3 Region: 1579-1693
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-17
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 4 Region: 551-611
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000108
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015716
Domain Number - Region: 1199-1394,1434-1484
Classification Level Classification E-value
Superfamily ARM repeat 0.0662
Family MIF4G domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015716   Gene: ENSMPUG00000015824   Transcript: ENSMPUT00000015957
Sequence length 1731
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:6545439:6594222:1 gene:ENSMPUG00000015824 transcript:ENSMPUT00000015957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLSLSTVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMADSEICGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDEQDKPLPVPSNQCCNWNYF
GWGEQQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYS
DSMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEQSLQGSEMEDERDRDS
YHSCHSSVSYHKDSPRWDQDEEELDEELDEELDEDLEDFLEEEEELPEEEEELEEEEEVP
DDIGSYTQREEVAVAEPKDFKRVSLPPAASEKEEKAPAVPAEAHDVAKAASEPAAPEEVP
TAERAPEPEPPKSEESFRRQEDEEGQEGQDSMSRAKANWLRAFNKVRLQLQEARGEGEMS
KSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEEL
KNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCH
EKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAVT
KTAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRT
KTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEV
RTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTD
VQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPG
VPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYR
NNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIF
NNCHELYSREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQ
FPQELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAELP
AFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDV
FSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIISKDFASYCSKEKEKVP
CILMNNTQQLRVQLEKMFEAMGGKELDAEASDILKELQVKLNNVLDELSRVFATSFQPHI
EECVKQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLK
RVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQMIFNA
AKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQ
SLRYALSLYTQATDLLIKTFVQTQAAQVHGGKGTRFTLSEDIYPEKGSGVEDPVGEVSVH
VELFTHPGTGEHKVTVKAVVAANDLKWQTSGIFRPFIEVNIIGPQLSDKKRKFATKSKNN
SWAPKYNESFQFTLSADVGPECYELQVCVKDYCFAREDRTVGLAVLQLRELAQRGSAACW
LPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
Download sequence
Identical sequences M3YWK6
ENSMPUP00000015716 ENSMPUP00000015716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]