SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015718 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015718
Domain Number 1 Region: 56-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-80
Family Protein kinases, catalytic subunit 0.00000203
Further Details:      
 
Domain Number 2 Region: 978-1036
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 1052-1172
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000215
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 4 Region: 1204-1456
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000262
Family Tricorn protease domain 2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015718   Gene: ENSMPUG00000015826   Transcript: ENSMPUT00000015959
Sequence length 1764
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896953.1:10248485:10577778:1 gene:ENSMPUG00000015826 transcript:ENSMPUT00000015959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFNGIDWDNIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPASLDLDVSVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTADGP
LTASKDLEIKTLKEEIEKLRKQVRESSHLEQQLEEANSVRRELDDAFRQIKAYEKQIKTL
QQEREELNKLEVHTEAVAAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGLCSIE
HQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKD
KLEKNRRESQSEREEFENEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSMRNQQLE
EEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELEALRNSSLGARA
TDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKAANIITECKLKDSEKKN
LELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPTDALDQFEDSFSSSSSSLIDF
LDDRSPSCTPASKGRRTDPVENTYVRNPNVKVNIQSRSTSPSTSSEAEPVKTVDSTPPPV
HTPTLRKKACPGSTGFPAKRKTHQFFVKSFTTPTRCHQCTSLMVGLIRQGCSCEVCGFSC
HITCVNKAPTACPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAVVCD
FKLFLYDVAEGKASQPSVVVSQVIDMRDEEFSVSSVLASDVIHASRKDIPCIFRVTASQL
SASDSRCSVLMLAESENERNKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTT
QAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHV
RLFPMSAFDGRETDFYKLAETKGCQSITSGKVCHGALTCLCVAMKRQVLCYELFQSKTRH
RKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGDGSPYSMLHSNDHTLSFIAHQPM
DAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPSSCCYNAPYLSVYSENAV
DVFDVNSMEWIQTLPLKKVRPLNSEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNS
RKQMVRNINNKRRFSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQ
ILKDLPMPGFPYPSPHHHSGLISSPINFEHIYHMTVHSAEKFLSPDSINPEYSPSLRSVP
GTPSFMPLRNPRPQESRAVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKR
EFSGGSYNAKWQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDSPRHSTASNSSNLSSP
PSPVSPRKTKSLSLESTDRGSWDP
Download sequence
Identical sequences M3YWK8
ENSMPUP00000015718 XP_004756885.1.14098 ENSMPUP00000015718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]