SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015723 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015723
Domain Number 1 Region: 25-133
Classification Level Classification E-value
Superfamily PWI domain 1.96e-45
Family PWI domain 0.000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015723   Gene: ENSMPUG00000015831   Transcript: ENSMPUT00000015964
Sequence length 213
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:21581627:21589799:-1 gene:ENSMPUG00000015831 transcript:ENSMPUT00000015964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRTKSRSP
SPAPEKKEKTPELPEPSVKVKEPSVQEATSTRQ
Download sequence
Identical sequences M3YWL3
ENSMPUP00000015723 ENSMPUP00000015723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]