SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015768 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015768
Domain Number 1 Region: 69-193
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000758
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015768
Domain Number - Region: 249-292
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 0.00155
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015768   Gene: ENSMPUG00000015874   Transcript: ENSMPUT00000016009
Sequence length 694
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:6628141:6644339:-1 gene:ENSMPUG00000015874 transcript:ENSMPUT00000016009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRPSSPLDKRQQQHLRGQVDTLLRNFLPCYREQLAASVLQQISRELGPREPAGCQLMR
SKKLPRVREHRGPLTQLGGHPPRWQPIFCVLRGDGRLEWFSHREEYENGGHPLGSTTLTG
YTVLTSQREYLHLLDTLCPVSSGEHTQEESDPLLEMPVNFPLFLQHPFRRHLCFSAATGE
AQRAWRLALQGGIRLRGTVLQRSQAPAARAFLDAVRLYRQHQGHFGDDDVTLGSDAEVLT
GVLMRKLLPALRAQTLPGLRGARRNRAWAWTEVGAGSRRGGLDTRGVAEADGGPTRGPIF
PLLSSVPETLSAVSLRLRLGLSVLAPPPHHGSVLRLWPVWGPLGRAGQLLDAVHAAVLAE
ASAGLRAFQPEKDELLAVLEKTIRPDVDQILRQRERLAGRLRVEVQRPLESCLHGKVDTQ
LSLVTQKLLSTMGAVLSAVQTLLAQGMDRLSGHLRGSSSGTQLRKEVYSFGEMPWDPELM
QTCYREAERSQGRLRQLVVPFGFFGTRSLMFGAQDLAQQLMADAVATFLQLADQCLTTAL
DCTQAAQQLEKVRGRVLKKFQSDSGSVQRNFTRGWLLSIFLPFVLHQLEGSCTVELLEFE
GDVLAVGSPALTVKGIYKDIVQGVLLQRIDGELKRALGARDVSCILDGCSEAPWDQTAVD
EEAEAQRGTRPGQPASGTEVQPLFPLPPPRTFCS
Download sequence
Identical sequences M3YWQ8
XP_012916050.1.14098 ENSMPUP00000015768 ENSMPUP00000015768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]