SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015774 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015774
Domain Number 1 Region: 547-698
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-60
Family Ankyrin repeat 0.0000181
Further Details:      
 
Domain Number 2 Region: 32-265,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-52
Family BAR domain 0.014
Further Details:      
 
Domain Number 3 Region: 432-547
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.23e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 302-400
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-20
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015774   Gene: ENSMPUG00000015880   Transcript: ENSMPUT00000016015
Sequence length 956
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:22460354:22505972:1 gene:ENSMPUG00000015880 transcript:ENSMPUT00000016015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQLSVAEFLAVTAEDLSSPAGANAFAAKIPRCRGAALAREEMLEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLVQNL
NNIVSFPLDSLLKGQLRDGRQDSKKQLEKAWKDYEARMARLEKERDRARVTGGTPGEVAQ
DTQRERRVFQLHMCEYLLRAGESQLKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLSPFI
EKLAASVHALRQAQEEELQKLIRLRDSLRGTLQLDSREETLSRKNSGGGGGGYSIHQHQG
NKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNP
EEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLAEPSGGGPGPWGGAG
LDGEPQDLTKLLIAEVKSRPGNGQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFS
RMQSLTLDLLGPSELLLALNIGNTRFNEVMEAQLPAQGGPKPSAESDMSTRRDYIVAKYV
EHRFARRSTPEPQRLRTAICNRDLLSVLEAFANGQDFGQLLPGPEGQAPGELALHLAIRV
ASPASLPLVDFIIQNGGHPDAKAADGNSALHWAALYNQPDCLKLLLKGRASLGTVNEAGE
TALDIARKKQHKECEELLEQAQAGTLTFPLHVDYNWGISPEPGSDSEEDEEEKRSPLKPP
AQARWASGRVDLSNKTYETIANLGSAAPQSQSEACPPPLPVKNPSRTMVQGRAGHASGDR
SEVPSLSCEPSGAPESLGRPASTSSTLTNPVDAAGPSQTPPSSEEGPSRPSLTSGGTPAE
MYPPVRFSSESTRSYRRGGLEPGRLSLSQAASAHKEHAGMSSGTVVRGVVAGHVGGRVGQ
QSMGGVGSWGPLPMARVYRRLGGHSSASPLRWCAPFPLQPGTHEAGESPGLEGRQR
Download sequence
Identical sequences M3YWR4
ENSMPUP00000015774 ENSMPUP00000015774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]