SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015805 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000015805
Domain Number - Region: 42-93
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00104
Family Snake venom toxins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015805   Gene: ENSMPUG00000015911   Transcript: ENSMPUT00000016046
Sequence length 93
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897302.1:39015:53018:-1 gene:ENSMPUG00000015911 transcript:ENSMPUT00000016046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAPGGLLACSLAFTPLLTASWEIKMNDLNEKDVDEFKSNGFKCSTCFAVMGRKCDNE
LKWCTADKIKCVEFSGIINTGLKDIAVEMKKCI
Download sequence
Identical sequences M3YWU5
ENSMPUP00000015805 ENSMPUP00000015805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]