SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015858 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015858
Domain Number 1 Region: 264-605
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.69e-72
Family p120GAP domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 112-240
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.7e-33
Family Synaptotagmin-like (S variant) 0.0016
Further Details:      
 
Domain Number 3 Region: 738-833
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 5.97e-32
Family RBP11/RpoL 0.00061
Further Details:      
 
Domain Number 4 Region: 565-706
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-30
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 5 Region: 7-129
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-27
Family PLC-like (P variant) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015858   Gene: ENSMPUG00000015962   Transcript: ENSMPUT00000016099
Sequence length 839
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896979.1:1644593:1675609:-1 gene:ENSMPUG00000015962 transcript:ENSMPUT00000016099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRSSLSIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHAVAFYVMDEDALSRDDVIGKVCLTRDTLAAHPKGFSGWAHLTEVDPDEEVQGEI
HLRLEVVPGTPAGRLRCSVLEARDLAPKDRNGASDPFVRVRYNGRTQETSIVKKSCYPRW
NETFEFDLEEGAAEAVCVEAWDWDLVSRNDFLGRVVFNVQRLWAAQQEEGWFRLQPDQSK
SRRGEGSLGSLQLEVRLRDETVLPSGCYQPLVRLLCREVKLGTQGPGQLIPLIEETTSTE
CRQEVATNLLKLFLGQGLAKDFLDLLFQLELGRTSEANTLFRSNSLASKSMESFLKVVGM
RYLHGVLGPIIDRVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEADVLEHSAQTLRIHLG
ALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHENVPFIAVTSFLCLRFLSPAIMA
PKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLKD
FITKLVDIGEKEELDLQRTLSLQAPPVKEGPLFIHRTKGKGHLMSSFKKLHFSLTTEALS
FAKTPSSKKSALIKLANIRAAEKVEEKSFGSSHVMQVIYEDDAGKAQTMYLQCKCVNELN
QWLSALRKVSISNPGLLGSYHPGVFRGDKWSCCHQKDKSDLGCDKTRSRVTLQEWNDPLD
HDLEAQLIYRHLLGVEAALRITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLF
AGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Download sequence
Identical sequences M3YWZ8
ENSMPUP00000015858 ENSMPUP00000015858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]