SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015905 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000015905
Domain Number - Region: 7-101
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0691
Family IMD domain 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015905   Gene: ENSMPUG00000016011   Transcript: ENSMPUT00000016148
Sequence length 345
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896979.1:2003976:2012743:1 gene:ENSMPUG00000016011 transcript:ENSMPUT00000016148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQNPPPAEAPLSQCLRDWEELQQDFQSIQETHRLYRLKLEELTKLQNGCTSAITRQKKQL
QELALVLKQCKRSLQSGAREAAQELENQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNV
TLLSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIR
ESILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQY
YYQSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFSLAR
DPECKEWQVLMCGFPFLLLFLGNFFTTLRVVHQKFHSQRRGSKKE
Download sequence
Identical sequences M3YX45
ENSMPUP00000015905 ENSMPUP00000015905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]