SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015917 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015917
Domain Number 1 Region: 4-68
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 3.53e-20
Family Surp module (SWAP domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 191-284
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.000000144
Family RPR domain (SMART 00582 ) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015917   Gene: ENSMPUG00000016023   Transcript: ENSMPUT00000016160
Sequence length 949
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:7333206:7350653:1 gene:ENSMPUG00000016023 transcript:ENSMPUT00000016160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMPLPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKL
ALEQQQLICKQQAPELEPAAALPPLPQPPLAPAAPIPSAQGAPSMDELIQQSQWNLQQQE
QHLLALRQEQVTAAVAHAVEQQMQKLLEETQLDMNEFDNLLQPIIDTCTKDAISAGKNWM
FSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKV
VVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQSPALGLGQYQATLINEYS
SVVQPVQLAFQQQIQTLKTQHEEFVNSLAQQQQQQQQQQQQQIQMPQMEAEVKATPPPPA
PPPAPTPAPTIPPTTQPDDSKPPIQMPGSSDYDASGGVQDPAAAGPRGPGPHDQIPPNKP
PWFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAP
WNSQPDPNWNSQFEGPWNSQHEQPPWGGGQREPPFRMQRPPHFRGPFPPHQQHPQFNQPP
HPHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPAEMGPPHHHPGHRMPHPGIN
EHPPWGGPQHPDFGPPPHGFNGQPPHMRRQGPPHINHDDPSLVPNVPYFDLPAGLMAPLV
KLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRA
KMRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSNSRSSKSSGSYSRSRSRSCSRSYSRS
RSRSRSRSRSRSRPPCRRSRSRSRSRSRSRSRSKSYSPGRRRRSRSRSPTPPSSAGLGSN
SAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGVKEQGIQDPIKGGDVRDKWDQYKGVGVA
LDDPYENYRRNKSYSFIARMKARDECKSQNPPGDAPATQPRASFPHQRS
Download sequence
Identical sequences M3YX57
ENSMPUP00000015917 ENSMPUP00000015917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]