SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015938 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015938
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Globin-like 5.78e-47
Family Globins 0.000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015938   Gene: ENSMPUG00000016045   Transcript: ENSMPUT00000016182
Sequence length 143
Comment pep:known scaffold:MusPutFur1.0:GL896925.1:15480185:15480863:-1 gene:ENSMPUG00000016045 transcript:ENSMPUT00000016182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSPADKTNVKSTWGKIGGHAGEYGGEALESRTFASFPTTKTYFPHFDLSHGSAQVKAH
GKKVADALTNAVAHMDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPAEFT
PAVHASLDKFFSAVSTVLTSKYR
Download sequence
Identical sequences M3YX78
ENSMPUP00000015938 ENSMPUP00000015938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]