SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015948 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015948
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 1.36e-48
Family Globins 0.000000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015948   Gene: ENSMPUG00000016055   Transcript: ENSMPUT00000016192
Sequence length 142
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:15484042:15485112:-1 gene:ENSMPUG00000016055 transcript:ENSMPUT00000016192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTKAERTVILSMWDKISTQAEAIGTQALERLFASYPQTKTYFPHFDLHPGSAHLRVHG
AKVVAALGEAVKSIDNIGGALAKLSELHAYILRVDPVNFKLLSHCLLVTVASHFPADFTA
DAHTAWDKFLSIVSCVLTEKYR
Download sequence
Identical sequences M3YX88
ENSMPUP00000015948 XP_004750991.1.14098 ENSMPUP00000015948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]