SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015950 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015950
Domain Number 1 Region: 80-410
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.29e-119
Family Rap/Ran-GAP 0.00000000000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015950   Gene: ENSMPUG00000016057   Transcript: ENSMPUT00000016194
Sequence length 689
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:24024194:24068934:1 gene:ENSMPUG00000016057 transcript:ENSMPUT00000016194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTN
HEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDV
IGDQEHLRLLLRTKCRTHHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRL
IVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFR
GGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDE
NTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPE
FQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GGGGGGFFESFKRAIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLLI
PGKSASRFGRRGSAIGIGTVEESLIVPGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRE
SPPAGQKTPDSGHASQEPKSENSSTQSSPEMPTTKNRAETTAQRAEVLKDFSRSSSSASS
FASVVEETEGGDADDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHP
DAGKSGDPACPEIKIQLEASEQHISQLGC
Download sequence
Identical sequences M3YX90
ENSMPUP00000015950 ENSMPUP00000015950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]