SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015959 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015959
Domain Number 1 Region: 432-738
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-75
Family p120GAP domain-like 0.0000338
Further Details:      
 
Domain Number 2 Region: 237-314
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000281
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 3 Region: 308-424
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000137
Family PLC-like (P variant) 0.071
Further Details:      
 
Domain Number 4 Region: 894-986
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000241
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015959   Gene: ENSMPUG00000016066   Transcript: ENSMPUT00000016203
Sequence length 1014
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:8080021:8091231:1 gene:ENSMPUG00000016066 transcript:ENSMPUT00000016203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPPSPCKTSQTQQAAASSPLTSYRWHTGGDGEKVAGGSRWGRLAGWGRALSHQEPRVSS
QPASRSLFRRVLSAPPKESRTSRLRLSKTLWARQKSLPLEPGPEPEAQEPEPEPETPAPQ
IPEAPTPDVPIWNIGAFALLDGKLVLLGGEEEGPCRPRAGSASSEGSIRVAMGNLRDPDR
TSGKTEPDTAGPNQVHNIRGLLKRLKEKKKARSELGASASRDGPPSALGSRESLATLSEL
DLGAERDVRVWPLHPSLLEEPHCFQVTWTGGSRCFSCRSAAERDRWIEDLRRHFQPSQDN
LEREETWLSVWVHEAKGLPRAAAGTAGVRAELWLDGALLARTAPRAGPGQLFWAERFHFE
ALPPARRLSLRLRGAGPGGAALGRVSLALEELGVPRAPAAGLERWFPLLGAPVGAVLRAR
IRARRLRVLPSERYKELAEFLTFHYARLCGALEPALSAQAKEELAAAMVRVLQATGRAQA
LVTDLGTAELARSGGREALLFRENTLATKAIDEYMKLVAQDYLQATLGQVVQRLCASSED
CEVDPSKCPAPELPQHQTRLRNSCEEVFQNIIHSYNWFPAELGTVFSGWREACKARGSEA
LGPRLVCASLFLRLLCPAILAPSLFGLAPEHPAPGPARALTLIAKVIQNLANSAPFGEKE
AYMGFMNSFLEDHGPAMQHFLDQVAMVDVDAAPSGYQGSSDLALQLAVLHAQLCTIFAEL
DQATRDSLEPLPTILRAIEEGRPVPVTVPMRLPPPPAQVHSSFSAGEKPGFLAPRDLPKH
TPLISKSQSFSVHGVHGAGSWARPQPDEERLPRPPRPVQRTQSVPAGRPARRRPSAGPRP
RPKSSLRTGPAPRSRPGTGASASLPRKPSVPWQRQLDQPRDRDQALGTHRPVGKLAELQR
EVAALREEQKALSGLVESLGTHLRVLTEKQEQLQGQLQDLDSRLREGTPQSNPGHGAPSS
EDHRLKNLERRLAEMERTQAQLRNVVDGLQLPRTSGSRSQPLPLKPACINGDTT
Download sequence
Identical sequences M3YX99
XP_012916168.1.14098 ENSMPUP00000015959 ENSMPUP00000015959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]