SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015983 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015983
Domain Number 1 Region: 1763-2008
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.09e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 799-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000738
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 3 Region: 571-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000178
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 4 Region: 1057-1167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000549
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 5 Region: 389-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 508-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000004
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 922-1043
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000816
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 159-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000157
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 9 Region: 237-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1139-1253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 275-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 12 Region: 200-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 1451-1484
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 14 Region: 122-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000998
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 16 Region: 43-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.032
Further Details:      
 
Domain Number 17 Region: 736-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 1370-1402
Classification Level Classification E-value
Superfamily Notch domain 0.000000968
Family Notch domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1324-1358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.028
Further Details:      
 
Domain Number 21 Region: 1410-1442
Classification Level Classification E-value
Superfamily Notch domain 0.00000119
Family Notch domain 0.0059
Further Details:      
 
Domain Number 22 Region: 774-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family EGF-type module 0.032
Further Details:      
 
Domain Number 23 Region: 693-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000686
Family EGF-type module 0.01
Further Details:      
 
Domain Number 24 Region: 81-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000182
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015983
Domain Number - Region: 1250-1283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000149
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015983   Gene: ENSMPUG00000016090   Transcript: ENSMPUT00000016227
Sequence length 2305
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:8299222:8332241:1 gene:ENSMPUG00000016090 transcript:ENSMPUT00000016227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGTRGRRRRRRRPMSSPPPLPPVWALPLLLLLAGPGAAAPPCLDGSPCMNGGRCTQLP
SREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSL
PDPCLSSPCTHGARCSVGPDGRYICSCPPGYQGRSCQSDVDECRVGGPCRHGGTCLNTPG
SFRCQCPAGYTGPLCENAAVPCAPSPCRNGGTCRQSGDFTYDCACLPGFEGQNCEVNVDD
CPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHS
CVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP
CHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC
GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCV
NGGVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLD
LVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASSPCGDGGSCVDGENGFRCLCPPGSLPPLCLPASHPCAQDPCSHGVCHDAPGGFRCV
CEPGWSGPRCSQSLARDACESQPCRSGGTCTSDGMGFHCACPPGVQGHQCELLSPCAPNP
CEHGGHCESVPGQLPVCSCPPGWQGPRCQQDVDECAGPSPCGSHGTCTNLEGSFSCTCHR
GYSGPSCDQDIDDCDPNPCLNGGSCQDGLGSFSCSCLPGFAGPRCARDVDECLSSPCGPG
TCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFHGGTCVDGVNSFSCQCRPGYTGAHC
QHEADPCLSRPCLHGGVCSAAHPGFRCTCPEGFTGAQCQTLVDWCSRAPCQNGGRCARTG
ATFYCLCPPGWSGRLCDIRSLPCREAAAQMGVRLEELCQTGGQCVDKDNSHYCVCPKGRT
GSHCEQEVDPCSGQPCQHGGTCRGYMGGYVCECPAGYTGDSCEDDVDECASQPCQHGGFC
IDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDQGPRCLHNGTCVDLVGGFRCSCPPGY
TGLRCEADINECHPGACHDAHTRDCLQDPGGGFRCICRPGFTGPRCQTALSPCESQPCQH
GGQCRPSPGPGGVLTFTCHCTPERWKGRGFLRNTENNWRERERERETVCVCVCVCVCVAG
RHKLASACLHGGSCRPAPLAPFFRCACAPGWAGPRCEAPTAAPEALEEPLCPSAACEAKS
GDKRCDRECNSPGCGWDGGDCSLSVGDPWRQCAALQCWRLFNNSRCDPACSSPACLYDNF
DCRAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCAGEVPALLARGVLVLT
VLLPPEELLRSSADFLQRLSGILRTSLRFRLDENGQAMVFPYHRPGPGSESRNRRELAPE
VIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRAVRGEPLEL
PEPSVPLLPLLAASAVFLLVILVLGVMVARRKREHSTLWFPEGFALHKDVAAGHKGRREP
VGQDALGMKNMAKSESLMGEVATDWMDTECPEAKRLKVEEPGVGAEDTVDCRQWTQHHLV
AADIRVAPAMALTPPQGDVDADGMDVNVRGPDGFTPLMLASFCGGALEPMPTEEDEAEDT
SASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPL
HTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVEELIASHADVNAVD
ELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSYEAAKLLLDHFA
NREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPHGPHGLGPLLCPPGAFLPGLKVA
QSGGKKSRRPPGKAGLGPQGTRGRGKKLTLACPGPLAESSVTLSPVDSLDSPRPFGGPPA
SPGGFSLEGPYAAATATAVSLAQLGGAGRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLP
PPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAAAGHGEEYPAAGTHGSPPKARFL
RVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATGPTATAAGALPAQPLPLSV
PGPLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences M3YXC3
ENSMPUP00000015983 ENSMPUP00000015983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]