SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015988 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015988
Domain Number 1 Region: 40-166
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000236
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015988   Gene: ENSMPUG00000016095   Transcript: ENSMPUT00000016232
Sequence length 925
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897033.1:461752:856551:1 gene:ENSMPUG00000016095 transcript:ENSMPUT00000016232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIKEEGASEEGQHFLPTPHANDTGDFQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLN
TLVQISVIHPAEQGLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDK
SHDTVRTSVLPEHKDPLPEVGRSFLGYASFEVGELLKSKEQLLALSLRTSDGGKVVGTIE
VSVVKMGEIEDGEADHITTDVQGQKCTLVCECTAPESVNGKDNLPFLNAVLKNPVCKLYR
FPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRNQELKELGELSPHWDNLRKNV
LTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMHVHSPHLKDAL
YDVITVGAPAAHFQGFKNGGLRKLLHRFEMERRNTGYQFIYYSPENTAKAKEVLSNINQL
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGG
VLKKPPSPKNSTEESCPQDPPAPMRRQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVD
RLIERDGSNEGGGGGSQDGEKDPSLVDPIITHPREDWYEQLYPLIRTLKDCMGEVVSRAK
QSLTFVLLQELAHSLPQGLMLTLRRDIVFSQALAGLVCGFIIKLHTSLHDPGFLQQLHTV
GLIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAKSNDVLPVITGRREHYVVEV
KLPARMFEALPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESINQENFELLKE
YYTAFMEKMPPDYTSHFQEQNDLKGLLENLHQNIQAKKRKNVEIMWLAATICRKLNGIRF
TCCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNVKCRKYA
FNMLQLMAFPKYYRPPEGTYGKADT
Download sequence
Identical sequences M3YXC8
XP_004768499.1.14098 ENSMPUP00000015988 ENSMPUP00000015988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]