SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016017 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016017
Domain Number 1 Region: 194-354
Classification Level Classification E-value
Superfamily SET domain 1.18e-39
Family Histone lysine methyltransferases 0.0000000446
Further Details:      
 
Domain Number 2 Region: 54-165
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.18e-27
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016017   Gene: ENSMPUG00000016124   Transcript: ENSMPUT00000016261
Sequence length 366
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897033.1:3004538:3044459:1 gene:ENSMPUG00000016124 transcript:ENSMPUT00000016261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRP
HFELVPGSSVYHFDKSTSSCISTRALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCIYDMFVHPRFGPIKCIRTLRAVEAEEELTVAYGYDHSPPGKNGPEAPEWYQVELKAF
QAAQQK
Download sequence
Identical sequences M3YXF7
ENSMPUP00000016017 ENSMPUP00000016017 XP_004768543.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]