SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016038 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016038
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000252
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016038   Gene: ENSMPUG00000016143   Transcript: ENSMPUT00000016282
Sequence length 549
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897199.1:892687:926626:1 gene:ENSMPUG00000016143 transcript:ENSMPUT00000016282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSPDVLEYYRSKHASKPIRAIDLSECAVWRHVGPGFPRKEFQNNFVFVVKTTSRTFYL
VAKTEVEMLVWVYSISQVCNLGQLEEGADPAESCSRGPPALQPAPGSCLPSGRASSSSRP
RGDLSTDFMATEDSRSESEFLPLPDYLILSNCETGRPRQASLPSRYDSCSTSERSLEQAS
SDDVFVDCPPPAAPAGSGRLLRCGSGSQKVLSLRPQATLTRSRDSTGLARDCCSSPLPEM
PLNATIRVDKNQGLLPYEATEHDLASCPPPPRPPKPSHLSERRQEQPLAGSVRPVGRPES
AAVPRRVSLSGLENVGTWKADVEGQSLRHRDKRLSLNLPCGFSPVYPTAPAGAEDGYVPM
GPQAAGSSLRTPCGHDDYIPMSPGSLSSPLPELPADLEPPPVNRDLKPQRKPRPPPLDLR
NLSTIREHACVTRTCTVPCNRTRFLSPERNGINSARFFANSVSREEEESYIHMNHRAAHS
LSGGTPTWARKSSLDYLALDFNSASPAPAQQKLLVSEEHKVDYVQVDERKTQALRSTRQE
WTDERQSKA
Download sequence
Identical sequences M3YXH8
XP_004779364.1.14098 XP_012904795.1.14098 XP_012904796.1.14098 ENSMPUP00000016038 ENSMPUP00000016038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]